Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 1092723..1093365 | Replicon | chromosome |
Accession | NZ_CP106987 | ||
Organism | Bacillus cereus strain IBA1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | OF864_RS05445 | Protein ID | WP_000635965.1 |
Coordinates | 1093015..1093365 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | OF864_RS05440 | Protein ID | WP_000004570.1 |
Coordinates | 1092723..1093010 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF864_RS05415 (OF864_05420) | 1088040..1089002 | + | 963 | WP_000961161.1 | UV DNA damage repair endonuclease UvsE | - |
OF864_RS05420 (OF864_05425) | 1088995..1089567 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
OF864_RS05425 (OF864_05430) | 1089661..1090020 | + | 360 | WP_000583417.1 | holo-ACP synthase | - |
OF864_RS05430 (OF864_05435) | 1090177..1091127 | + | 951 | WP_002004297.1 | outer membrane lipoprotein carrier protein LolA | - |
OF864_RS05435 (OF864_05440) | 1091245..1092414 | + | 1170 | WP_000390617.1 | alanine racemase | - |
OF864_RS05440 (OF864_05445) | 1092723..1093010 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
OF864_RS05445 (OF864_05450) | 1093015..1093365 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OF864_RS05450 (OF864_05455) | 1093433..1095601 | + | 2169 | WP_000426241.1 | Tex family protein | - |
OF864_RS05455 (OF864_05460) | 1095659..1095775 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
OF864_RS05460 (OF864_05465) | 1095970..1096428 | + | 459 | WP_000344241.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T260109 WP_000635965.1 NZ_CP106987:1093015-1093365 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |