Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 153843..154582 Replicon plasmid pQL2
Accession NZ_CP106965
Organism Klebsiella variicola strain SY1

Toxin (Protein)


Gene name tacT Uniprot ID A0A5E1AVR5
Locus tag OCU08_RS27500 Protein ID WP_013087172.1
Coordinates 153843..154328 (-) Length 162 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID A0A5E1AWX8
Locus tag OCU08_RS27505 Protein ID WP_012540086.1
Coordinates 154316..154582 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCU08_RS27450 148999..149211 - 213 WP_128206254.1 hypothetical protein -
OCU08_RS27455 149272..149601 - 330 WP_164875724.1 hypothetical protein -
OCU08_RS27460 149613..149825 - 213 WP_047722603.1 hypothetical protein -
OCU08_RS27465 149863..150060 - 198 Protein_170 single-stranded DNA-binding protein -
OCU08_RS27470 150692..151009 - 318 WP_032747192.1 hypothetical protein -
OCU08_RS27475 151024..151374 - 351 WP_042938321.1 hypothetical protein -
OCU08_RS27480 151371..151643 - 273 WP_114268495.1 hypothetical protein -
OCU08_RS27485 151949..153156 - 1208 Protein_174 IS256 family transposase -
OCU08_RS27490 153342..153461 - 120 WP_223230170.1 Hok/Gef family protein -
OCU08_RS27495 153409..153522 - 114 Protein_176 FlmC family protein -
OCU08_RS27500 153843..154328 - 486 WP_013087172.1 GNAT family N-acetyltransferase Toxin
OCU08_RS27505 154316..154582 - 267 WP_012540086.1 DUF1778 domain-containing protein Antitoxin
OCU08_RS27510 154882..155205 + 324 WP_012540250.1 metalloregulator ArsR/SmtB family transcription factor -
OCU08_RS27515 155207..155920 + 714 WP_012540184.1 arsenical resistance protein ArsH -
OCU08_RS27520 155929..156474 + 546 WP_012540227.1 sigma-70 family RNA polymerase sigma factor -
OCU08_RS27525 156550..156912 + 363 WP_049010935.1 arsenic metallochaperone ArsD family protein -
OCU08_RS27530 156939..158690 + 1752 WP_162866166.1 arsenical pump-driving ATPase -
OCU08_RS27535 158815..159351 + 537 WP_012540238.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..183783 183783


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(27-152)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 162 a.a.        Molecular weight: 17810.62 Da        Isoelectric Point: 9.8560

>T260108 WP_013087172.1 NZ_CP106965:c154328-153843 [Klebsiella variicola]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q

Download         Length: 486 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10076.47 Da        Isoelectric Point: 4.3721

>AT260108 WP_012540086.1 NZ_CP106965:c154582-154316 [Klebsiella variicola]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACQAAENVILDRRVFNFNDEQYAEFIDMLDAPVADDPAIDKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E1AVR5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E1AWX8

References