Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8385..9028 Replicon plasmid pQL2
Accession NZ_CP106965
Organism Klebsiella variicola strain SY1

Toxin (Protein)


Gene name vagD Uniprot ID A0A3A3ZBE4
Locus tag OCU08_RS26670 Protein ID WP_007374381.1
Coordinates 8612..9028 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID G8LQB1
Locus tag OCU08_RS26665 Protein ID WP_007853351.1
Coordinates 8385..8615 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCU08_RS26635 3444..4453 + 1010 Protein_4 IS110 family transposase -
OCU08_RS26640 4679..4795 - 117 Protein_5 transposase -
OCU08_RS26645 5331..5936 + 606 WP_074416312.1 hypothetical protein -
OCU08_RS26650 6126..7130 - 1005 WP_131024499.1 hypothetical protein -
OCU08_RS26655 7160..7306 - 147 Protein_8 hypothetical protein -
OCU08_RS26660 7575..7889 - 315 WP_131024500.1 hypothetical protein -
OCU08_RS26665 8385..8615 + 231 WP_007853351.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OCU08_RS26670 8612..9028 + 417 WP_007374381.1 type II toxin-antitoxin system VapC family toxin Toxin
OCU08_RS26675 9101..10663 + 1563 WP_042936981.1 AAA family ATPase -
OCU08_RS26680 10648..11670 + 1023 WP_007374383.1 hypothetical protein -
OCU08_RS26685 11879..12436 + 558 WP_007374384.1 OsmC family protein -
OCU08_RS26690 12620..13189 + 570 WP_042936984.1 TetR/AcrR family transcriptional regulator -
OCU08_RS26695 13206..13544 + 339 WP_007374386.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..183783 183783


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15105.57 Da        Isoelectric Point: 7.8882

>T260107 WP_007374381.1 NZ_CP106965:8612-9028 [Klebsiella variicola]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGATGPKAAPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8674.77 Da        Isoelectric Point: 4.4692

>AT260107 WP_007853351.1 NZ_CP106965:8385-8615 [Klebsiella variicola]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3A3ZBE4

Antitoxin

Source ID Structure
AlphaFold DB A0A3A3Z894

References