Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4950738..4951254 | Replicon | chromosome |
| Accession | NZ_CP106964 | ||
| Organism | Klebsiella variicola strain SY1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OCU08_RS23935 | Protein ID | WP_022065401.1 |
| Coordinates | 4950738..4951022 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | OCU08_RS23940 | Protein ID | WP_002886901.1 |
| Coordinates | 4951012..4951254 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCU08_RS23920 | 4945841..4947496 | + | 1656 | WP_117146636.1 | alpha,alpha-phosphotrehalase | - |
| OCU08_RS23925 | 4947882..4950020 | + | 2139 | WP_044614392.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OCU08_RS23930 | 4950270..4950734 | + | 465 | WP_012969085.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OCU08_RS23935 | 4950738..4951022 | - | 285 | WP_022065401.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OCU08_RS23940 | 4951012..4951254 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OCU08_RS23945 | 4951332..4953242 | - | 1911 | WP_012969086.1 | PRD domain-containing protein | - |
| OCU08_RS23950 | 4953265..4954419 | - | 1155 | WP_012969087.1 | lactonase family protein | - |
| OCU08_RS23955 | 4954545..4955285 | - | 741 | WP_008807137.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11128.97 Da Isoelectric Point: 10.2849
>T260104 WP_022065401.1 NZ_CP106964:c4951022-4950738 [Klebsiella variicola]
MTYELEFDPRAWREWQMPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQMPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|