Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4209381..4210000 Replicon chromosome
Accession NZ_CP106964
Organism Klebsiella variicola strain SY1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OCU08_RS20420 Protein ID WP_002892050.1
Coordinates 4209782..4210000 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag OCU08_RS20415 Protein ID WP_008805436.1
Coordinates 4209381..4209755 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCU08_RS20405 4204536..4205729 + 1194 WP_008805438.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OCU08_RS20410 4205752..4208898 + 3147 WP_012968813.1 multidrug efflux RND transporter permease subunit AcrB -
OCU08_RS20415 4209381..4209755 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
OCU08_RS20420 4209782..4210000 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OCU08_RS20425 4210159..4210725 + 567 WP_016160393.1 maltose O-acetyltransferase -
OCU08_RS20430 4210697..4210825 - 129 Protein_4009 hypothetical protein -
OCU08_RS20435 4210862..4211332 + 471 WP_008805434.1 YlaC family protein -
OCU08_RS20440 4211301..4212758 - 1458 WP_008805433.1 PLP-dependent aminotransferase family protein -
OCU08_RS20445 4212859..4213557 + 699 WP_064323876.1 GNAT family protein -
OCU08_RS20450 4213554..4213694 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OCU08_RS20455 4213694..4213957 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260102 WP_002892050.1 NZ_CP106964:4209782-4210000 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT260102 WP_008805436.1 NZ_CP106964:4209381-4209755 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References