Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1833091..1833681 | Replicon | chromosome |
Accession | NZ_CP106964 | ||
Organism | Klebsiella variicola strain SY1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
Locus tag | OCU08_RS08855 | Protein ID | WP_008804165.1 |
Coordinates | 1833349..1833681 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
Locus tag | OCU08_RS08850 | Protein ID | WP_012541132.1 |
Coordinates | 1833091..1833348 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCU08_RS08830 | 1828698..1829273 | + | 576 | WP_072122291.1 | hypothetical protein | - |
OCU08_RS08835 | 1829452..1830288 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
OCU08_RS08840 | 1830495..1831466 | + | 972 | WP_012541130.1 | sensor domain-containing diguanylate cyclase | - |
OCU08_RS08845 | 1831463..1832563 | - | 1101 | WP_072122293.1 | AarF/UbiB family protein | - |
OCU08_RS08850 | 1833091..1833348 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
OCU08_RS08855 | 1833349..1833681 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OCU08_RS08865 | 1834004..1835440 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
OCU08_RS08875 | 1835815..1837269 | - | 1455 | WP_008804170.1 | AMP nucleosidase | - |
OCU08_RS08880 | 1837400..1837645 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T260095 WP_008804165.1 NZ_CP106964:1833349-1833681 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LYA2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZQ3 |