Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324854..325440 Replicon chromosome
Accession NZ_CP106964
Organism Klebsiella variicola strain SY1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OCU08_RS01495 Protein ID WP_012967118.1
Coordinates 325072..325440 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OCU08_RS01490 Protein ID WP_004174006.1
Coordinates 324854..325075 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OCU08_RS01470 321011..321937 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OCU08_RS01475 321934..323211 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
OCU08_RS01480 323208..323975 + 768 WP_008806972.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OCU08_RS01485 323977..324690 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OCU08_RS01490 324854..325075 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OCU08_RS01495 325072..325440 + 369 WP_012967118.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OCU08_RS01500 325732..327048 + 1317 WP_022066271.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OCU08_RS01505 327155..328042 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OCU08_RS01510 328039..328884 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OCU08_RS01515 328886..329956 + 1071 WP_023323353.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 321934..331037 9103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(26-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13584.98 Da        Isoelectric Point: 8.6410

>T260091 WP_012967118.1 NZ_CP106964:325072-325440 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGMTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT260091 WP_004174006.1 NZ_CP106964:324854-325075 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References