Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 284214..284845 | Replicon | chromosome |
Accession | NZ_CP106964 | ||
Organism | Klebsiella variicola strain SY1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2V3KJT3 |
Locus tag | OCU08_RS01285 | Protein ID | WP_044650325.1 |
Coordinates | 284214..284489 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | R4YIG2 |
Locus tag | OCU08_RS01290 | Protein ID | WP_004181489.1 |
Coordinates | 284486..284845 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCU08_RS01265 | 279450..279785 | + | 336 | WP_002921203.1 | universal stress protein UspB | - |
OCU08_RS01270 | 279845..281341 | - | 1497 | WP_008806938.1 | inorganic phosphate transporter PitA | - |
OCU08_RS01275 | 281571..282764 | + | 1194 | WP_012967106.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OCU08_RS01280 | 282804..283817 | - | 1014 | WP_012540371.1 | magnesium transporter | - |
OCU08_RS01285 | 284214..284489 | + | 276 | WP_044650325.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OCU08_RS01290 | 284486..284845 | + | 360 | WP_004181489.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OCU08_RS01295 | 284873..285274 | - | 402 | WP_004181488.1 | nickel-responsive transcriptional regulator NikR | - |
OCU08_RS01300 | 285262..286053 | - | 792 | WP_012540373.1 | nickel import ATP-binding protein NikE | - |
OCU08_RS01305 | 286050..286814 | - | 765 | WP_008806946.1 | nickel import ATP-binding protein NikD | - |
OCU08_RS01310 | 286814..287647 | - | 834 | WP_012967107.1 | nickel ABC transporter permease subunit NikC | - |
OCU08_RS01315 | 287644..288588 | - | 945 | WP_023323359.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10279.91 Da Isoelectric Point: 10.3165
>T260090 WP_044650325.1 NZ_CP106964:284214-284489 [Klebsiella variicola]
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
MEQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13313.02 Da Isoelectric Point: 4.4605
>AT260090 WP_004181489.1 NZ_CP106964:284486-284845 [Klebsiella variicola]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKMKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V3KJT3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M5Q1 |