Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 3416062..3417040 | Replicon | chromosome |
| Accession | NZ_CP106947 | ||
| Organism | Bacillus thuringiensis strain 4F5 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | OAT02_RS17745 | Protein ID | WP_000624977.1 |
| Coordinates | 3416303..3417040 (-) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | W8YZL5 |
| Locus tag | OAT02_RS17740 | Protein ID | WP_000237818.1 |
| Coordinates | 3416062..3416190 (-) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OAT02_RS17710 (OAT02_17710) | 3411580..3412331 | + | 752 | Protein_3437 | IS21-like element IS232 family helper ATPase IstB | - |
| OAT02_RS17715 (OAT02_17715) | 3412383..3412643 | - | 261 | Protein_3438 | hypothetical protein | - |
| OAT02_RS17720 (OAT02_17720) | 3412669..3413478 | - | 810 | WP_000678509.1 | papain-like cysteine protease family protein | - |
| OAT02_RS17725 (OAT02_17725) | 3413721..3415193 | - | 1473 | WP_053513522.1 | beta-Ala-His dipeptidase | - |
| OAT02_RS17730 (OAT02_17730) | 3415405..3415794 | + | 390 | WP_000713866.1 | YxeA family protein | - |
| OAT02_RS17735 (OAT02_17735) | 3415813..3415989 | - | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| OAT02_RS17740 (OAT02_17740) | 3416062..3416190 | - | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
| OAT02_RS17745 (OAT02_17745) | 3416303..3417040 | - | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| OAT02_RS17750 (OAT02_17750) | 3417278..3418015 | - | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| OAT02_RS17755 (OAT02_17755) | 3418182..3418664 | - | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OAT02_RS17760 (OAT02_17760) | 3418772..3420457 | + | 1686 | WP_074644145.1 | alpha-keto acid decarboxylase family protein | - |
| OAT02_RS17765 (OAT02_17765) | 3420615..3421397 | - | 783 | WP_000381800.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T260089 WP_000624977.1 NZ_CP106947:c3417040-3416303 [Bacillus thuringiensis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|