Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 89550..90192 | Replicon | chromosome |
| Accession | NZ_CP106947 | ||
| Organism | Bacillus thuringiensis strain 4F5 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | OAT02_RS00475 | Protein ID | WP_000635965.1 |
| Coordinates | 89550..89900 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | OAT02_RS00480 | Protein ID | WP_000004570.1 |
| Coordinates | 89905..90192 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OAT02_RS00460 (OAT02_00460) | 86486..86944 | - | 459 | WP_000344241.1 | SprT family protein | - |
| OAT02_RS00465 (OAT02_00465) | 87140..87256 | + | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| OAT02_RS00470 (OAT02_00470) | 87314..89482 | - | 2169 | WP_000426236.1 | Tex family protein | - |
| OAT02_RS00475 (OAT02_00475) | 89550..89900 | - | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OAT02_RS00480 (OAT02_00480) | 89905..90192 | - | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| OAT02_RS00485 (OAT02_00485) | 90501..91670 | - | 1170 | WP_053514326.1 | alanine racemase | - |
| OAT02_RS00490 (OAT02_00490) | 91788..92738 | - | 951 | WP_053514347.1 | outer membrane lipoprotein carrier protein LolA | - |
| OAT02_RS00495 (OAT02_00495) | 92895..93254 | - | 360 | WP_000583417.1 | holo-ACP synthase | - |
| OAT02_RS00500 (OAT02_00500) | 93348..93920 | + | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
| OAT02_RS00505 (OAT02_00505) | 93913..94875 | - | 963 | WP_000961161.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T260088 WP_000635965.1 NZ_CP106947:c89900-89550 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |