Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 9986..10511 Replicon plasmid pMFDS1001074
Accession NZ_CP106930
Organism Escherichia coli strain MFDS1001074

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag OEG89_RS23980 Protein ID WP_001159871.1
Coordinates 10206..10511 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID -
Locus tag OEG89_RS23975 Protein ID WP_000813633.1
Coordinates 9986..10204 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG89_RS23950 (5948) 5948..6109 + 162 Protein_6 transposase -
OEG89_RS23955 (6532) 6532..6738 + 207 Protein_7 plasmid-partitioning protein -
OEG89_RS23960 (6846) 6846..7396 + 551 Protein_8 IS3 family transposase -
OEG89_RS23965 (7553) 7553..8095 - 543 WP_227640688.1 T3SS effector NleG family protein -
OEG89_RS23970 (8607) 8607..9524 + 918 WP_000155223.1 M14 family metallocarboxypeptidase -
OEG89_RS23975 (9986) 9986..10204 + 219 WP_000813633.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OEG89_RS23980 (10206) 10206..10511 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
OEG89_RS23985 (10512) 10512..11225 + 714 WP_000016984.1 tyrosine-type recombinase/integrase -
OEG89_RS23990 (11362) 11362..11637 - 276 WP_000239529.1 hypothetical protein -
OEG89_RS23995 (11631) 11631..12275 - 645 WP_000633911.1 AAA family ATPase -
OEG89_RS24000 (12504) 12504..13475 + 972 WP_001103700.1 plasmid segregation protein ParM -
OEG89_RS24005 (13480) 13480..13872 + 393 WP_000340832.1 plasmid partitioning/stability family protein -
OEG89_RS24010 (13877) 13877..14551 - 675 Protein_18 DUF4113 domain-containing protein -
OEG89_RS24015 (14618) 14618..15401 - 784 Protein_19 IS21-like element IS100kyp family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..59536 59536


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T260087 WP_001159871.1 NZ_CP106930:10206-10511 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8329.31 Da        Isoelectric Point: 4.5203

>AT260087 WP_000813633.1 NZ_CP106930:9986-10204 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVALFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure

References