Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4307976..4308594 | Replicon | chromosome |
Accession | NZ_CP106929 | ||
Organism | Escherichia coli strain MFDS1001074 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OEG89_RS21405 | Protein ID | WP_001291435.1 |
Coordinates | 4307976..4308194 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | OEG89_RS21410 | Protein ID | WP_000344800.1 |
Coordinates | 4308220..4308594 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG89_RS21370 (4303265) | 4303265..4303837 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
OEG89_RS21375 (4303868) | 4303868..4304179 | - | 312 | WP_000409911.1 | MGMT family protein | - |
OEG89_RS21385 (4304558) | 4304558..4304911 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OEG89_RS21390 (4304953) | 4304953..4306503 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OEG89_RS21395 (4306667) | 4306667..4307137 | - | 471 | WP_000136192.1 | YlaC family protein | - |
OEG89_RS21400 (4307253) | 4307253..4307804 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OEG89_RS21405 (4307976) | 4307976..4308194 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OEG89_RS21410 (4308220) | 4308220..4308594 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
OEG89_RS21415 (4309140) | 4309140..4312289 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
OEG89_RS21420 (4312312) | 4312312..4313505 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260086 WP_001291435.1 NZ_CP106929:c4308194-4307976 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT260086 WP_000344800.1 NZ_CP106929:c4308594-4308220 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |