Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3726477..3727309 | Replicon | chromosome |
| Accession | NZ_CP106929 | ||
| Organism | Escherichia coli strain MFDS1001074 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | OEG89_RS18605 | Protein ID | WP_000854753.1 |
| Coordinates | 3726935..3727309 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | OEG89_RS18600 | Protein ID | WP_001315620.1 |
| Coordinates | 3726477..3726845 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG89_RS18560 (3721826) | 3721826..3721957 | - | 132 | Protein_3612 | IS3 family transposase | - |
| OEG89_RS18565 (3722239) | 3722239..3722430 | + | 192 | Protein_3613 | hypothetical protein | - |
| OEG89_RS18570 (3722648) | 3722648..3722773 | - | 126 | Protein_3614 | hemolysin activation protein | - |
| OEG89_RS18575 (3723521) | 3723521..3723727 | + | 207 | Protein_3615 | autotransporter adhesin family protein | - |
| OEG89_RS18580 (3723848) | 3723848..3725383 | + | 1536 | WP_000939409.1 | protein YeeR | - |
| OEG89_RS18585 (3725368) | 3725368..3725538 | + | 171 | Protein_3617 | antirestriction protein | - |
| OEG89_RS18590 (3725554) | 3725554..3726030 | + | 477 | WP_001186774.1 | RadC family protein | - |
| OEG89_RS18595 (3726093) | 3726093..3726314 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| OEG89_RS18600 (3726477) | 3726477..3726845 | + | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OEG89_RS18605 (3726935) | 3726935..3727309 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| OEG89_RS18610 (3727306) | 3727306..3727794 | + | 489 | WP_000777547.1 | DUF5983 family protein | - |
| OEG89_RS18615 (3727806) | 3727806..3728003 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| OEG89_RS18620 (3728088) | 3728088..3728237 | + | 150 | Protein_3624 | restriction endonuclease subunit M | - |
| OEG89_RS18625 (3729005) | 3729005..3729148 | - | 144 | Protein_3625 | HNH endonuclease | - |
| OEG89_RS18630 (3729285) | 3729285..3729935 | + | 651 | WP_001037966.1 | HNH endonuclease | - |
| OEG89_RS18635 (3729943) | 3729943..3730923 | - | 981 | WP_000991415.1 | sialate O-acetylesterase | - |
| OEG89_RS18640 (3730988) | 3730988..3732094 | - | 1107 | WP_001341302.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC / fimD / fimF / fimG / fimH | 3703403..3748864 | 45461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T260083 WP_000854753.1 NZ_CP106929:3726935-3727309 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT260083 WP_001315620.1 NZ_CP106929:3726477-3726845 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |