Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3726477..3727309 Replicon chromosome
Accession NZ_CP106929
Organism Escherichia coli strain MFDS1001074

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag OEG89_RS18605 Protein ID WP_000854753.1
Coordinates 3726935..3727309 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0ULY5
Locus tag OEG89_RS18600 Protein ID WP_001315620.1
Coordinates 3726477..3726845 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG89_RS18560 (3721826) 3721826..3721957 - 132 Protein_3612 IS3 family transposase -
OEG89_RS18565 (3722239) 3722239..3722430 + 192 Protein_3613 hypothetical protein -
OEG89_RS18570 (3722648) 3722648..3722773 - 126 Protein_3614 hemolysin activation protein -
OEG89_RS18575 (3723521) 3723521..3723727 + 207 Protein_3615 autotransporter adhesin family protein -
OEG89_RS18580 (3723848) 3723848..3725383 + 1536 WP_000939409.1 protein YeeR -
OEG89_RS18585 (3725368) 3725368..3725538 + 171 Protein_3617 antirestriction protein -
OEG89_RS18590 (3725554) 3725554..3726030 + 477 WP_001186774.1 RadC family protein -
OEG89_RS18595 (3726093) 3726093..3726314 + 222 WP_000692345.1 DUF987 domain-containing protein -
OEG89_RS18600 (3726477) 3726477..3726845 + 369 WP_001315620.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OEG89_RS18605 (3726935) 3726935..3727309 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
OEG89_RS18610 (3727306) 3727306..3727794 + 489 WP_000777547.1 DUF5983 family protein -
OEG89_RS18615 (3727806) 3727806..3728003 + 198 WP_000839281.1 DUF957 domain-containing protein -
OEG89_RS18620 (3728088) 3728088..3728237 + 150 Protein_3624 restriction endonuclease subunit M -
OEG89_RS18625 (3729005) 3729005..3729148 - 144 Protein_3625 HNH endonuclease -
OEG89_RS18630 (3729285) 3729285..3729935 + 651 WP_001037966.1 HNH endonuclease -
OEG89_RS18635 (3729943) 3729943..3730923 - 981 WP_000991415.1 sialate O-acetylesterase -
OEG89_RS18640 (3730988) 3730988..3732094 - 1107 WP_001341302.1 N-acetylneuraminate epimerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE / fimA / fimI / fimC / fimD / fimF / fimG / fimH 3703403..3748864 45461


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T260083 WP_000854753.1 NZ_CP106929:3726935-3727309 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13474.20 Da        Isoelectric Point: 6.2050

>AT260083 WP_001315620.1 NZ_CP106929:3726477-3726845 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB V0ULY5

References