Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3510989..3511773 Replicon chromosome
Accession NZ_CP106929
Organism Escherichia coli strain MFDS1001074

Toxin (Protein)


Gene name yeeV Uniprot ID C7BUQ8
Locus tag OEG89_RS17415 Protein ID WP_000854717.1
Coordinates 3510989..3511315 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID C7BUQ9
Locus tag OEG89_RS17420 Protein ID WP_001285644.1
Coordinates 3511405..3511773 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG89_RS17395 (3506970) 3506970..3508508 - 1539 WP_001187173.1 lysine decarboxylation/transport transcriptional activator CadC -
OEG89_RS17400 (3509318) 3509318..3510160 - 843 WP_001382663.1 DUF4942 domain-containing protein -
OEG89_RS17405 (3510245) 3510245..3510442 - 198 WP_000839233.1 DUF957 domain-containing protein -
OEG89_RS17410 (3510454) 3510454..3510888 - 435 WP_000532709.1 DUF5983 family protein -
OEG89_RS17415 (3510989) 3510989..3511315 - 327 WP_000854717.1 TA system toxin CbtA family protein Toxin
OEG89_RS17420 (3511405) 3511405..3511773 - 369 WP_001285644.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OEG89_RS17425 (3511850) 3511850..3512005 - 156 Protein_3390 helix-turn-helix domain-containing protein -
OEG89_RS17430 (3512072) 3512072..3512329 - 258 Protein_3391 transposase -
OEG89_RS17435 (3512394) 3512394..3512504 - 111 Protein_3392 IS66 family insertion sequence element accessory protein TnpB -
OEG89_RS17440 (3512501) 3512501..3512935 - 435 WP_001309734.1 transposase -
OEG89_RS17445 (3513022) 3513022..3513318 - 297 Protein_3394 IS256 family transposase -
OEG89_RS17450 (3513509) 3513509..3515075 - 1567 Protein_3395 IS66 family transposase -
OEG89_RS17455 (3515095) 3515095..3515442 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
OEG89_RS17460 (3515442) 3515442..3516117 - 676 Protein_3397 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - efa1 / efa1 / espG / escE / cesAB / escK / escL / escR / escS / escT / escU / etgA / cesD / escC / sepD / escJ / escI / sepZ/espZ / cesL / escV / escN / escO / sepQ/escQ / espH / cesF / map / tir / cesT / eae / escD / sepL / espA / espD / espB / cesD2 / escF / escG / espF 3499482..3563612 64130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 12194.91 Da        Isoelectric Point: 6.4697

>T260082 WP_000854717.1 NZ_CP106929:c3511315-3510989 [Escherichia coli]
MKTLPDTHVREASRCPSPVIIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDN

Download         Length: 327 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13533.31 Da        Isoelectric Point: 5.0235

>AT260082 WP_001285644.1 NZ_CP106929:c3511773-3511405 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGVCLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C7BUQ8

Antitoxin

Source ID Structure
AlphaFold DB C7BUQ9

References