Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2185092..2185746 | Replicon | chromosome |
Accession | NZ_CP106929 | ||
Organism | Escherichia coli strain MFDS1001074 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OEG89_RS11035 | Protein ID | WP_000244777.1 |
Coordinates | 2185092..2185499 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OEG89_RS11040 | Protein ID | WP_000354046.1 |
Coordinates | 2185480..2185746 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG89_RS11015 (2181049) | 2181049..2182782 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OEG89_RS11020 (2182788) | 2182788..2183498 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OEG89_RS11025 (2183523) | 2183523..2184419 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OEG89_RS11030 (2184531) | 2184531..2185052 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
OEG89_RS11035 (2185092) | 2185092..2185499 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
OEG89_RS11040 (2185480) | 2185480..2185746 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OEG89_RS11045 (2185989) | 2185989..2186969 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
OEG89_RS11050 (2187165) | 2187165..2187824 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
OEG89_RS11055 (2187988) | 2187988..2188299 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
OEG89_RS11060 (2188344) | 2188344..2189777 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
OEG89_RS11065 (2189834) | 2189834..2190577 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T260077 WP_000244777.1 NZ_CP106929:c2185499-2185092 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |