Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2048557..2049140 | Replicon | chromosome |
Accession | NZ_CP106929 | ||
Organism | Escherichia coli strain MFDS1001074 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | OEG89_RS10420 | Protein ID | WP_000254738.1 |
Coordinates | 2048557..2048892 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OEG89_RS10425 | Protein ID | WP_000581937.1 |
Coordinates | 2048892..2049140 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG89_RS10405 (2044444) | 2044444..2045742 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
OEG89_RS10410 (2045830) | 2045830..2047467 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OEG89_RS10415 (2047695) | 2047695..2048486 | - | 792 | WP_001071661.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OEG89_RS10420 (2048557) | 2048557..2048892 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
OEG89_RS10425 (2048892) | 2048892..2049140 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OEG89_RS10430 (2049218) | 2049218..2051452 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
OEG89_RS10435 (2051500) | 2051500..2052801 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T260076 WP_000254738.1 NZ_CP106929:c2048892-2048557 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|