Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1200112..1200947 | Replicon | chromosome |
| Accession | NZ_CP106929 | ||
| Organism | Escherichia coli strain MFDS1001074 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2T3T4L0 |
| Locus tag | OEG89_RS06225 | Protein ID | WP_001556084.1 |
| Coordinates | 1200570..1200947 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OEG89_RS06220 | Protein ID | WP_001383228.1 |
| Coordinates | 1200112..1200480 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG89_RS06190 (1195232) | 1195232..1195405 | - | 174 | Protein_1212 | cobalamin biosynthesis protein | - |
| OEG89_RS06195 (1195384) | 1195384..1195572 | - | 189 | Protein_1213 | IS4 family transposase | - |
| OEG89_RS06200 (1196606) | 1196606..1196939 | + | 334 | Protein_1214 | transposase | - |
| OEG89_RS06205 (1197135) | 1197135..1198345 | + | 1211 | Protein_1215 | PfkB family carbohydrate kinase | - |
| OEG89_RS06210 (1198359) | 1198359..1199117 | + | 759 | WP_001710425.1 | glutamine amidotransferase | - |
| OEG89_RS06215 (1199174) | 1199174..1200076 | + | 903 | Protein_1217 | DMT family transporter | - |
| OEG89_RS06220 (1200112) | 1200112..1200480 | + | 369 | WP_001383228.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OEG89_RS06225 (1200570) | 1200570..1200947 | + | 378 | WP_001556084.1 | TA system toxin CbtA family protein | Toxin |
| OEG89_RS06230 (1200944) | 1200944..1201093 | + | 150 | Protein_1220 | DUF5983 family protein | - |
| OEG89_RS06235 (1201193) | 1201193..1201273 | + | 81 | Protein_1221 | hypothetical protein | - |
| OEG89_RS06240 (1202071) | 1202071..1202460 | + | 390 | WP_089079246.1 | transposase | - |
| OEG89_RS06245 (1202731) | 1202731..1203096 | + | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| OEG89_RS06250 (1203197) | 1203197..1203526 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| OEG89_RS06255 (1203698) | 1203698..1204756 | - | 1059 | WP_001200892.1 | FUSC family protein | - |
| OEG89_RS06260 (1204955) | 1204955..1205428 | - | 474 | WP_001105385.1 | DNA gyrase inhibitor SbmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1196823..1196939 | 116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14232.27 Da Isoelectric Point: 7.8276
>T260074 WP_001556084.1 NZ_CP106929:1200570-1200947 [Escherichia coli]
MKTLPDTHVRELSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRELSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13617.32 Da Isoelectric Point: 6.2058
>AT260074 WP_001383228.1 NZ_CP106929:1200112-1200480 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|