Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 571427..572065 | Replicon | chromosome |
Accession | NZ_CP106929 | ||
Organism | Escherichia coli strain MFDS1001074 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OEG89_RS02900 | Protein ID | WP_000813794.1 |
Coordinates | 571427..571603 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OEG89_RS02905 | Protein ID | WP_001270286.1 |
Coordinates | 571649..572065 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG89_RS02880 (567046) | 567046..568221 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
OEG89_RS02885 (568313) | 568313..568849 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OEG89_RS02890 (568922) | 568922..570883 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OEG89_RS02895 (570975) | 570975..571205 | - | 231 | WP_000494244.1 | YncJ family protein | - |
OEG89_RS02900 (571427) | 571427..571603 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OEG89_RS02905 (571649) | 571649..572065 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OEG89_RS02910 (572144) | 572144..573550 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OEG89_RS02915 (573795) | 573795..574940 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
OEG89_RS02920 (574958) | 574958..575971 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OEG89_RS02925 (575972) | 575972..576913 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T260067 WP_000813794.1 NZ_CP106929:571427-571603 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT260067 WP_001270286.1 NZ_CP106929:571649-572065 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|