Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 107222..107701 Replicon chromosome
Accession NZ_CP106929
Organism Escherichia coli strain MFDS1001074

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag OEG89_RS00500 Protein ID WP_001373944.1
Coordinates 107222..107509 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag OEG89_RS00505 Protein ID WP_001300743.1
Coordinates 107510..107701 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG89_RS00470 (102342) 102342..102584 - 243 WP_000273151.1 DUF4224 domain-containing protein -
OEG89_RS00475 (102652) 102652..105087 - 2436 WP_000048584.1 exonuclease -
OEG89_RS00480 (105181) 105181..105372 - 192 WP_001098307.1 DUF1482 family protein -
OEG89_RS00485 (105369) 105369..105557 - 189 WP_000413705.1 cell division inhibition protein DicB -
OEG89_RS00490 (106261) 106261..106707 + 447 WP_000373334.1 hypothetical protein -
OEG89_RS00495 (106806) 106806..106958 - 153 WP_000367377.1 DUF1391 family protein -
OEG89_RS00500 (107222) 107222..107509 - 288 WP_001373944.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OEG89_RS00505 (107510) 107510..107701 - 192 WP_001300743.1 hypothetical protein Antitoxin
OEG89_RS00510 (107670) 107670..108131 - 462 WP_000538413.1 helix-turn-helix domain-containing protein -
OEG89_RS00515 (108162) 108162..108533 - 372 WP_000448218.1 hypothetical protein -
OEG89_RS00520 (108636) 108636..108917 + 282 WP_021577226.1 YdaS family helix-turn-helix protein -
OEG89_RS00525 (108921) 108921..109346 + 426 WP_000693855.1 toxin YdaT family protein -
OEG89_RS00530 (109553) 109553..110008 - 456 WP_001486451.1 hypothetical protein -
OEG89_RS00535 (110087) 110087..111202 + 1116 WP_001205821.1 hypothetical protein -
OEG89_RS00540 (111209) 111209..111955 + 747 WP_000788751.1 ATP-binding protein -
OEG89_RS00545 (111977) 111977..112156 + 180 Protein_108 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - nleB2 100278..120434 20156


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10955.69 Da        Isoelectric Point: 6.7144

>T260066 WP_001373944.1 NZ_CP106929:c107509-107222 [Escherichia coli]
MLPVLWLESADADLDNITSYIARFDIDAAERLWKRLRTCVLPLSEHPYLYPPSDRVPGLRETVAHPNYIILYRVTISGIE
IVNVVHARRQFPVTP

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7350.26 Da        Isoelectric Point: 5.8256

>AT260066 WP_001300743.1 NZ_CP106929:c107701-107510 [Escherichia coli]
MNTALSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVERRMAERFANMRKERSKQ

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References