Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3786362..3787041 | Replicon | chromosome |
| Accession | NZ_CP106924 | ||
| Organism | Escherichia coli strain MFDS1016424 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | OEG87_RS18620 | Protein ID | WP_000854680.1 |
| Coordinates | 3786700..3787041 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | OEG87_RS18615 | Protein ID | WP_000070396.1 |
| Coordinates | 3786362..3786679 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG87_RS18570 (3781800) | 3781800..3782621 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| OEG87_RS18575 (3782838) | 3782838..3783539 | + | 702 | WP_001581462.1 | WYL domain-containing protein | - |
| OEG87_RS18580 (3783580) | 3783580..3783816 | + | 237 | WP_001144031.1 | protein YpjK | - |
| OEG87_RS18585 (3783816) | 3783816..3784259 | + | 444 | WP_032199444.1 | lipoprotein YafY | - |
| OEG87_RS18590 (3784282) | 3784282..3784749 | + | 468 | WP_263307862.1 | protein YkfB | - |
| OEG87_RS18595 (3784826) | 3784826..3785065 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| OEG87_RS18600 (3785163) | 3785163..3785621 | + | 459 | WP_032177818.1 | antirestriction protein | - |
| OEG87_RS18605 (3785637) | 3785637..3786113 | + | 477 | WP_000811693.1 | RadC family protein | - |
| OEG87_RS18610 (3786122) | 3786122..3786343 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| OEG87_RS18615 (3786362) | 3786362..3786679 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| OEG87_RS18620 (3786700) | 3786700..3787041 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| OEG87_RS18625 (3787704) | 3787704..3787916 | + | 213 | Protein_3644 | integrase core domain-containing protein | - |
| OEG87_RS18630 (3787958) | 3787958..3788701 | - | 744 | WP_032170462.1 | AraC family transcriptional regulator | - |
| OEG87_RS18640 (3789962) | 3789962..3790249 | - | 288 | Protein_3647 | hypothetical protein | - |
| OEG87_RS18645 (3790411) | 3790411..3790467 | + | 57 | WP_211180520.1 | protein YsgD | - |
| OEG87_RS18650 (3790619) | 3790619..3791569 | + | 951 | WP_000947148.1 | magnesium/cobalt transporter CorA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3781800..3797792 | 15992 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T260059 WP_000854680.1 NZ_CP106924:3786700-3787041 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|