Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3786362..3787041 Replicon chromosome
Accession NZ_CP106924
Organism Escherichia coli strain MFDS1016424

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag OEG87_RS18620 Protein ID WP_000854680.1
Coordinates 3786700..3787041 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag OEG87_RS18615 Protein ID WP_000070396.1
Coordinates 3786362..3786679 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG87_RS18570 (3781800) 3781800..3782621 + 822 WP_000197389.1 DUF932 domain-containing protein -
OEG87_RS18575 (3782838) 3782838..3783539 + 702 WP_001581462.1 WYL domain-containing protein -
OEG87_RS18580 (3783580) 3783580..3783816 + 237 WP_001144031.1 protein YpjK -
OEG87_RS18585 (3783816) 3783816..3784259 + 444 WP_032199444.1 lipoprotein YafY -
OEG87_RS18590 (3784282) 3784282..3784749 + 468 WP_263307862.1 protein YkfB -
OEG87_RS18595 (3784826) 3784826..3785065 + 240 WP_000194654.1 DUF905 family protein -
OEG87_RS18600 (3785163) 3785163..3785621 + 459 WP_032177818.1 antirestriction protein -
OEG87_RS18605 (3785637) 3785637..3786113 + 477 WP_000811693.1 RadC family protein -
OEG87_RS18610 (3786122) 3786122..3786343 + 222 WP_000691994.1 DUF987 domain-containing protein -
OEG87_RS18615 (3786362) 3786362..3786679 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
OEG87_RS18620 (3786700) 3786700..3787041 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
OEG87_RS18625 (3787704) 3787704..3787916 + 213 Protein_3644 integrase core domain-containing protein -
OEG87_RS18630 (3787958) 3787958..3788701 - 744 WP_032170462.1 AraC family transcriptional regulator -
OEG87_RS18640 (3789962) 3789962..3790249 - 288 Protein_3647 hypothetical protein -
OEG87_RS18645 (3790411) 3790411..3790467 + 57 WP_211180520.1 protein YsgD -
OEG87_RS18650 (3790619) 3790619..3791569 + 951 WP_000947148.1 magnesium/cobalt transporter CorA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3781800..3797792 15992


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T260059 WP_000854680.1 NZ_CP106924:3786700-3787041 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT260059 WP_000070396.1 NZ_CP106924:3786362-3786679 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References