Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3591514..3592351 | Replicon | chromosome |
Accession | NZ_CP106924 | ||
Organism | Escherichia coli strain MFDS1016424 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | OEG87_RS17685 | Protein ID | WP_000227784.1 |
Coordinates | 3591809..3592351 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | OEG87_RS17680 | Protein ID | WP_001297137.1 |
Coordinates | 3591514..3591825 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG87_RS17655 (3586534) | 3586534..3587481 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
OEG87_RS17660 (3587503) | 3587503..3589494 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
OEG87_RS17665 (3589484) | 3589484..3590098 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
OEG87_RS17670 (3590098) | 3590098..3590427 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
OEG87_RS17675 (3590439) | 3590439..3591329 | + | 891 | WP_000971336.1 | heme o synthase | - |
OEG87_RS17680 (3591514) | 3591514..3591825 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
OEG87_RS17685 (3591809) | 3591809..3592351 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
OEG87_RS17690 (3592407) | 3592407..3593342 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
OEG87_RS17695 (3593750) | 3593750..3595114 | + | 1365 | WP_001000974.1 | MFS transporter | - |
OEG87_RS17700 (3595242) | 3595242..3595733 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
OEG87_RS17705 (3595901) | 3595901..3596812 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T260058 WP_000227784.1 NZ_CP106924:3591809-3592351 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|