Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2381915..2382553 | Replicon | chromosome |
Accession | NZ_CP106924 | ||
Organism | Escherichia coli strain MFDS1016424 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OEG87_RS11570 | Protein ID | WP_000813794.1 |
Coordinates | 2382377..2382553 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OEG87_RS11565 | Protein ID | WP_001270286.1 |
Coordinates | 2381915..2382331 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG87_RS11545 (2377067) | 2377067..2378008 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
OEG87_RS11550 (2378009) | 2378009..2379022 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OEG87_RS11555 (2379040) | 2379040..2380185 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
OEG87_RS11560 (2380430) | 2380430..2381836 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
OEG87_RS11565 (2381915) | 2381915..2382331 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OEG87_RS11570 (2382377) | 2382377..2382553 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OEG87_RS11575 (2382775) | 2382775..2383005 | + | 231 | WP_000494244.1 | YncJ family protein | - |
OEG87_RS11580 (2383097) | 2383097..2385058 | - | 1962 | WP_075826559.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OEG87_RS11585 (2385131) | 2385131..2385667 | - | 537 | WP_000429152.1 | DNA-binding transcriptional regulator SutR | - |
OEG87_RS11590 (2385759) | 2385759..2386934 | + | 1176 | WP_001236296.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2386974..2388122 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T260056 WP_000813794.1 NZ_CP106924:c2382553-2382377 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT260056 WP_001270286.1 NZ_CP106924:c2382331-2381915 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|