Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1823503..1824335 | Replicon | chromosome |
| Accession | NZ_CP106924 | ||
| Organism | Escherichia coli strain MFDS1016424 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | OEG87_RS08780 | Protein ID | WP_000854765.1 |
| Coordinates | 1823503..1823877 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | OEG87_RS08785 | Protein ID | WP_001295723.1 |
| Coordinates | 1823967..1824335 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG87_RS08745 (1818962) | 1818962..1819291 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| OEG87_RS08750 (1819392) | 1819392..1819658 | - | 267 | WP_001360325.1 | EutP/PduV family microcompartment system protein | - |
| OEG87_RS08755 (1819848) | 1819848..1820630 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| OEG87_RS08760 (1820627) | 1820627..1821649 | - | 1023 | Protein_1712 | IS21-like element IS100 family transposase | - |
| OEG87_RS08765 (1821987) | 1821987..1822376 | - | 390 | WP_077249349.1 | transposase | - |
| OEG87_RS08770 (1823174) | 1823174..1823254 | - | 81 | Protein_1714 | hypothetical protein | - |
| OEG87_RS08775 (1823354) | 1823354..1823506 | - | 153 | Protein_1715 | DUF5983 family protein | - |
| OEG87_RS08780 (1823503) | 1823503..1823877 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| OEG87_RS08785 (1823967) | 1823967..1824335 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OEG87_RS08790 (1824498) | 1824498..1824719 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| OEG87_RS08795 (1824788) | 1824788..1825264 | - | 477 | WP_001354275.1 | RadC family protein | - |
| OEG87_RS08800 (1825280) | 1825280..1825753 | - | 474 | WP_001372806.1 | antirestriction protein | - |
| OEG87_RS08805 (1826095) | 1826095..1826490 | - | 396 | Protein_1721 | DUF945 domain-containing protein | - |
| OEG87_RS08810 (1826521) | 1826521..1828092 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| OEG87_RS08815 (1828112) | 1828112..1828459 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OEG87_RS08820 (1828459) | 1828459..1829134 | - | 676 | Protein_1724 | IS66-like element accessory protein TnpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1819848..1828665 | 8817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T260050 WP_000854765.1 NZ_CP106924:c1823877-1823503 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT260050 WP_001295723.1 NZ_CP106924:c1824335-1823967 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|