Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1823503..1824335 Replicon chromosome
Accession NZ_CP106924
Organism Escherichia coli strain MFDS1016424

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag OEG87_RS08780 Protein ID WP_000854765.1
Coordinates 1823503..1823877 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag OEG87_RS08785 Protein ID WP_001295723.1
Coordinates 1823967..1824335 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG87_RS08745 (1818962) 1818962..1819291 + 330 WP_000450409.1 DUF496 family protein -
OEG87_RS08750 (1819392) 1819392..1819658 - 267 WP_001360325.1 EutP/PduV family microcompartment system protein -
OEG87_RS08755 (1819848) 1819848..1820630 - 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -
OEG87_RS08760 (1820627) 1820627..1821649 - 1023 Protein_1712 IS21-like element IS100 family transposase -
OEG87_RS08765 (1821987) 1821987..1822376 - 390 WP_077249349.1 transposase -
OEG87_RS08770 (1823174) 1823174..1823254 - 81 Protein_1714 hypothetical protein -
OEG87_RS08775 (1823354) 1823354..1823506 - 153 Protein_1715 DUF5983 family protein -
OEG87_RS08780 (1823503) 1823503..1823877 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
OEG87_RS08785 (1823967) 1823967..1824335 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OEG87_RS08790 (1824498) 1824498..1824719 - 222 WP_000692345.1 DUF987 domain-containing protein -
OEG87_RS08795 (1824788) 1824788..1825264 - 477 WP_001354275.1 RadC family protein -
OEG87_RS08800 (1825280) 1825280..1825753 - 474 WP_001372806.1 antirestriction protein -
OEG87_RS08805 (1826095) 1826095..1826490 - 396 Protein_1721 DUF945 domain-containing protein -
OEG87_RS08810 (1826521) 1826521..1828092 - 1572 WP_000381395.1 IS66-like element ISCro1 family transposase -
OEG87_RS08815 (1828112) 1828112..1828459 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
OEG87_RS08820 (1828459) 1828459..1829134 - 676 Protein_1724 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 1819848..1828665 8817


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T260050 WP_000854765.1 NZ_CP106924:c1823877-1823503 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT260050 WP_001295723.1 NZ_CP106924:c1824335-1823967 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References