Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1329616..1330241 | Replicon | chromosome |
Accession | NZ_CP106924 | ||
Organism | Escherichia coli strain MFDS1016424 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OEG87_RS06535 | Protein ID | WP_000911330.1 |
Coordinates | 1329843..1330241 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | OEG87_RS06530 | Protein ID | WP_000450524.1 |
Coordinates | 1329616..1329843 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG87_RS06505 (1325419) | 1325419..1325889 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
OEG87_RS06510 (1325889) | 1325889..1326461 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
OEG87_RS06515 (1326607) | 1326607..1327485 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
OEG87_RS06520 (1327502) | 1327502..1328536 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
OEG87_RS06525 (1328749) | 1328749..1329462 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
OEG87_RS06530 (1329616) | 1329616..1329843 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
OEG87_RS06535 (1329843) | 1329843..1330241 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OEG87_RS06540 (1330388) | 1330388..1331251 | + | 864 | WP_001267495.1 | neutral zinc metallopeptidase | - |
OEG87_RS06545 (1331266) | 1331266..1333281 | + | 2016 | WP_075826571.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
OEG87_RS06550 (1333355) | 1333355..1334053 | + | 699 | WP_000679812.1 | esterase | - |
OEG87_RS06555 (1334163) | 1334163..1334363 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T260048 WP_000911330.1 NZ_CP106924:1329843-1330241 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|