Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 869852..870506 | Replicon | chromosome |
Accession | NZ_CP106924 | ||
Organism | Escherichia coli strain MFDS1016424 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OEG87_RS04255 | Protein ID | WP_000244777.1 |
Coordinates | 870099..870506 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OEG87_RS04250 | Protein ID | WP_000354046.1 |
Coordinates | 869852..870118 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG87_RS04230 (866140) | 866140..866451 | + | 312 | WP_134694384.1 | N(4)-acetylcytidine aminohydrolase | - |
OEG87_RS04235 (866615) | 866615..867274 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
OEG87_RS04240 (867397) | 867397..868376 | - | 980 | Protein_831 | IS110-like element IS621 family transposase | - |
OEG87_RS04245 (868629) | 868629..869609 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
OEG87_RS04250 (869852) | 869852..870118 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OEG87_RS04255 (870099) | 870099..870506 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
OEG87_RS04260 (870546) | 870546..871067 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
OEG87_RS04265 (871179) | 871179..872075 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OEG87_RS04270 (872100) | 872100..872810 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OEG87_RS04275 (872816) | 872816..874549 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T260045 WP_000244777.1 NZ_CP106924:870099-870506 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |