Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 304899..305699 | Replicon | chromosome |
| Accession | NZ_CP106924 | ||
| Organism | Escherichia coli strain MFDS1016424 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | OEG87_RS01415 | Protein ID | WP_000342451.1 |
| Coordinates | 305172..305699 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | OEG87_RS01410 | Protein ID | WP_001277108.1 |
| Coordinates | 304899..305165 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG87_RS01390 (300557) | 300557..301225 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| OEG87_RS01395 (301218) | 301218..302276 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| OEG87_RS01400 (302520) | 302520..303374 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| OEG87_RS01405 (303646) | 303646..304749 | + | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| OEG87_RS01410 (304899) | 304899..305165 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| OEG87_RS01415 (305172) | 305172..305699 | + | 528 | WP_000342451.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| OEG87_RS01420 (305696) | 305696..306079 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| OEG87_RS01425 (306503) | 306503..307612 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| OEG87_RS01430 (307660) | 307660..308586 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OEG87_RS01435 (308583) | 308583..309860 | + | 1278 | WP_000803798.1 | branched chain amino acid ABC transporter permease LivM | - |
| OEG87_RS01440 (309857) | 309857..310624 | + | 768 | WP_000082110.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19749.73 Da Isoelectric Point: 7.3232
>T260043 WP_000342451.1 NZ_CP106924:305172-305699 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|