Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1661239..1661924 Replicon chromosome
Accession NZ_CP106921
Organism Neisseria gonorrhoeae strain 10272

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDL74_RS08660 Protein ID WP_003689143.1
Coordinates 1661742..1661924 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDL74_RS08655 Protein ID WP_003691454.1
Coordinates 1661239..1661640 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDL74_RS08615 (NDL74_08615) 1656656..1656838 - 183 WP_003691535.1 hypothetical protein -
NDL74_RS08620 (NDL74_08620) 1656978..1657664 - 687 WP_010357532.1 hypothetical protein -
NDL74_RS08625 (NDL74_08625) 1657733..1657894 - 162 WP_003691530.1 hypothetical protein -
NDL74_RS08630 (NDL74_08630) 1657891..1658166 - 276 WP_151266294.1 hypothetical protein -
NDL74_RS08635 (NDL74_08635) 1658320..1658652 - 333 WP_003695500.1 hypothetical protein -
NDL74_RS08640 (NDL74_08640) 1659198..1659959 + 762 WP_012503753.1 hypothetical protein -
NDL74_RS08645 (NDL74_08645) 1660048..1660464 - 417 WP_003700378.1 hypothetical protein -
NDL74_RS08650 (NDL74_08650) 1660473..1661057 - 585 WP_003693477.1 Panacea domain-containing protein -
NDL74_RS08655 (NDL74_08655) 1661239..1661640 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDL74_RS08660 (NDL74_08660) 1661742..1661924 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDL74_RS08665 (NDL74_08665) 1662094..1662912 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDL74_RS08670 (NDL74_08670) 1663187..1663942 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDL74_RS08675 (NDL74_08675) 1664079..1664264 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDL74_RS08680 (NDL74_08680) 1664353..1664508 + 156 WP_003698902.1 hypothetical protein -
NDL74_RS08685 (NDL74_08685) 1664485..1664673 - 189 WP_003691445.1 hypothetical protein -
NDL74_RS08690 (NDL74_08690) 1664846..1665073 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDL74_RS08695 (NDL74_08695) 1665070..1666032 + 963 WP_229940817.1 helix-turn-helix domain-containing protein -
NDL74_RS08700 (NDL74_08700) 1666048..1666827 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1644911..1679329 34418


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T260041 WP_003689143.1 NZ_CP106921:c1661924-1661742 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT260041 WP_003691454.1 NZ_CP106921:c1661640-1661239 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References