Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 656612..657267 | Replicon | chromosome |
Accession | NZ_CP106921 | ||
Organism | Neisseria gonorrhoeae strain 10272 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDL74_RS03515 | Protein ID | WP_003691083.1 |
Coordinates | 656848..657267 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDL74_RS03510 | Protein ID | WP_003688410.1 |
Coordinates | 656612..656848 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDL74_RS03480 (NDL74_03480) | 651747..652034 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDL74_RS03485 (NDL74_03485) | 652106..653272 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDL74_RS03490 (NDL74_03490) | 653283..654173 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NDL74_RS03495 (NDL74_03495) | 654556..654942 | - | 387 | Protein_683 | IS110 family transposase | - |
NDL74_RS03500 (NDL74_03500) | 655292..655582 | + | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
NDL74_RS03505 (NDL74_03505) | 655587..656165 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
NDL74_RS03510 (NDL74_03510) | 656612..656848 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDL74_RS03515 (NDL74_03515) | 656848..657267 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDL74_RS03520 (NDL74_03520) | 657416..658870 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDL74_RS03525 (NDL74_03525) | 658867..659568 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDL74_RS03530 (NDL74_03530) | 659565..660344 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDL74_RS03535 (NDL74_03535) | 660492..662033 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260040 WP_003691083.1 NZ_CP106921:656848-657267 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|