Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1703773..1704458 Replicon chromosome
Accession NZ_CP106918
Organism Neisseria gonorrhoeae strain 9071

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag ND436_RS09135 Protein ID WP_003689143.1
Coordinates 1704276..1704458 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag ND436_RS09130 Protein ID WP_003691454.1
Coordinates 1703773..1704174 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND436_RS09090 (ND436_009090) 1699191..1699373 - 183 WP_003691535.1 hypothetical protein -
ND436_RS09095 (ND436_009095) 1699513..1700199 - 687 WP_010951053.1 hypothetical protein -
ND436_RS09100 (ND436_009100) 1700268..1700429 - 162 WP_003691530.1 hypothetical protein -
ND436_RS09105 (ND436_009105) 1700426..1700701 - 276 WP_033911205.1 hypothetical protein -
ND436_RS09110 (ND436_009110) 1700854..1701186 - 333 WP_003695500.1 hypothetical protein -
ND436_RS09115 (ND436_009115) 1701732..1702493 + 762 WP_012503753.1 hypothetical protein -
ND436_RS09120 (ND436_009120) 1702582..1702998 - 417 WP_003700378.1 hypothetical protein -
ND436_RS09125 (ND436_009125) 1703007..1703591 - 585 WP_003693477.1 Panacea domain-containing protein -
ND436_RS09130 (ND436_009130) 1703773..1704174 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
ND436_RS09135 (ND436_009135) 1704276..1704458 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
ND436_RS09140 (ND436_009140) 1704628..1705446 - 819 WP_003693474.1 DUF3037 domain-containing protein -
ND436_RS09145 (ND436_009145) 1705721..1706476 - 756 WP_003693472.1 LexA family transcriptional regulator -
ND436_RS09150 (ND436_009150) 1706613..1706798 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
ND436_RS09155 (ND436_009155) 1706887..1707042 + 156 WP_003698902.1 hypothetical protein -
ND436_RS09160 (ND436_009160) 1707019..1707207 - 189 WP_003691445.1 hypothetical protein -
ND436_RS09165 (ND436_009165) 1707380..1707607 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
ND436_RS09170 (ND436_009170) 1707604..1708116 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
ND436_RS09175 (ND436_009175) 1708130..1708660 + 531 WP_229931507.1 hypothetical protein -
ND436_RS09180 (ND436_009180) 1708675..1709454 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1687446..1721956 34510


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T260038 WP_003689143.1 NZ_CP106918:c1704458-1704276 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT260038 WP_003691454.1 NZ_CP106918:c1704174-1703773 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References