Detailed information of TA system TA260037

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicA-HicB
• Location: 1180864..1181548
• Replicon: chromosome
• Accession: NZ_CP106918
• Organism: Neisseria gonorrhoeae strain 9071

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: -
• Locus tag: ND436_RS06405
• Protein ID: WP_260253391.1
• Coordinates: 1180864..1181046 (+)
• Length: 61 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: Q5F6D2
• Locus tag: ND436_RS06410
• Protein ID: WP_003691454.1
• Coordinates: 1181147..1181548 (+)
• Length: 134 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ND436_RS06370 (ND436_006370)	1175870..1176769	-	900	WP_041421306.1	replication protein	-
ND436_RS06375 (ND436_006375)	1176966..1177166	-	201	WP_012503750.1	hypothetical protein	-
ND436_RS06380 (ND436_006380)	1177168..1177302	-	135	WP_229684436.1	YdaS family helix-turn-helix protein	-
ND436_RS06385 (ND436_006385)	1177518..1178204	+	687	WP_012503751.1	helix-turn-helix transcriptional regulator	-
ND436_RS06390 (ND436_006390)	1178244..1178942	+	699	WP_002212401.1	S24 family peptidase	-
ND436_RS06395 (ND436_006395)	1179181..1179879	+	699	WP_003689139.1	hypothetical protein	-
ND436_RS06400 (ND436_006400)	1179876..1180694	+	819	WP_012503752.1	DUF3037 domain-containing protein	-
ND436_RS06405 (ND436_006405)	1180864..1181046	+	183	WP_260253391.1	type II toxin-antitoxin system HicA family toxin	Toxin
ND436_RS06410 (ND436_006410)	1181147..1181548	+	402	WP_003691454.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
ND436_RS06415 (ND436_006415)	1181647..1181880	-	234	WP_265524977.1	hypothetical protein	-
ND436_RS06420 (ND436_006420)	1181987..1182409	-	423	WP_265524978.1	hypothetical protein	-
ND436_RS06425 (ND436_006425)	1182630..1182830	+	201	WP_003704298.1	hypothetical protein	-
ND436_RS06430 (ND436_006430)	1182863..1183339	+	477	WP_002255718.1	hypothetical protein	-
ND436_RS06435 (ND436_006435)	1183336..1183617	+	282	WP_260253380.1	hypothetical protein	-
ND436_RS06440 (ND436_006440)	1183718..1184089	+	372	WP_260253326.1	hypothetical protein	-
ND436_RS06445 (ND436_006445)	1184242..1184475	+	234	WP_260253389.1	hypothetical protein	-
ND436_RS06450 (ND436_006450)	1184515..1184676	+	162	WP_003691530.1	hypothetical protein	-
ND436_RS06455 (ND436_006455)	1184745..1185101	+	357	WP_260253387.1	hypothetical protein	-
ND436_RS06460 (ND436_006460)	1185068..1185451	+	384	WP_260253386.1	hypothetical protein	-
ND436_RS06465 (ND436_006465)	1185569..1185748	+	180	WP_260253385.1	hypothetical protein	-
ND436_RS06470 (ND436_006470)	1185745..1186236	+	492	WP_260253384.1	siphovirus Gp157 family protein	-
ND436_RS06475 (ND436_006475)	1186288..1186434	+	147	WP_260253383.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1142283..1197696	55413

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (5-59)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (4-126)

Sequences

Toxin

Protein

• Length: 61 a.a.
• Molecular weight: 6793.90 Da
• Isoelectric Point: 10.6112

>T260037 WP_260253391.1 NZ_CP106918:1180864-1181046 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKYRVTVPHPKKDLPTGTVKNIYKQAGLK

Nucleotide

• Length: 183 bp

Antitoxin

Protein

• Length: 134 a.a.
• Molecular weight: 14634.43 Da
• Isoelectric Point: 4.5457

>AT260037 WP_003691454.1 NZ_CP106918:1181147-1181548 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Nucleotide

• Length: 402 bp

Structures

Antitoxin

• AlphaFold DB: Q5F6D2