Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 697565..698220 | Replicon | chromosome |
Accession | NZ_CP106918 | ||
Organism | Neisseria gonorrhoeae strain 9071 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | ND436_RS03965 | Protein ID | WP_003691083.1 |
Coordinates | 697801..698220 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | ND436_RS03960 | Protein ID | WP_003688410.1 |
Coordinates | 697565..697801 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND436_RS03930 (ND436_003930) | 692700..692987 | + | 288 | WP_003688407.1 | hypothetical protein | - |
ND436_RS03935 (ND436_003935) | 693059..694225 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
ND436_RS03940 (ND436_003940) | 694236..695126 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
ND436_RS03945 (ND436_003945) | 695509..695895 | - | 387 | Protein_772 | IS110 family transposase | - |
ND436_RS03950 (ND436_003950) | 696245..696535 | + | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
ND436_RS03955 (ND436_003955) | 696540..697118 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
ND436_RS03960 (ND436_003960) | 697565..697801 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
ND436_RS03965 (ND436_003965) | 697801..698220 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
ND436_RS03970 (ND436_003970) | 698369..699823 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
ND436_RS03975 (ND436_003975) | 699820..700521 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
ND436_RS03980 (ND436_003980) | 700518..701297 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
ND436_RS03985 (ND436_003985) | 701445..702986 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260036 WP_003691083.1 NZ_CP106918:697801-698220 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|