Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17183..17826 Replicon plasmid unnamed3
Accession NZ_CP106915
Organism Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OE131_RS29370 Protein ID WP_001044770.1
Coordinates 17183..17599 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OE131_RS29375 Protein ID WP_001261282.1
Coordinates 17596..17826 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE131_RS29345 (12630) 12630..13334 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
OE131_RS29350 (13394) 13394..13558 - 165 Protein_15 IS5/IS1182 family transposase -
OE131_RS29360 (14540) 14540..15562 - 1023 WP_000361404.1 helicase UvrD -
OE131_RS29365 (15547) 15547..17109 - 1563 WP_004206609.1 AAA family ATPase -
OE131_RS29370 (17183) 17183..17599 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OE131_RS29375 (17596) 17596..17826 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OE131_RS29380 (17783) 17783..18244 + 462 WP_014343465.1 hypothetical protein -
OE131_RS29385 (18405) 18405..19349 + 945 WP_011977810.1 hypothetical protein -
OE131_RS29390 (19386) 19386..19778 + 393 WP_011977811.1 hypothetical protein -
OE131_RS29395 (19836) 19836..20357 + 522 WP_013214008.1 hypothetical protein -
OE131_RS29400 (20403) 20403..20606 + 204 WP_235295287.1 hypothetical protein -
OE131_RS29405 (20636) 20636..21640 + 1005 WP_011977814.1 hypothetical protein -
OE131_RS29410 (21824) 21824..22603 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / fosA3 / blaTEM-1B / rmtB - 1..120349 120349


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260029 WP_001044770.1 NZ_CP106915:c17599-17183 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260029 WP_001261282.1 NZ_CP106915:c17826-17596 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References