Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 142625..143295 Replicon plasmid unnamed1
Accession NZ_CP106913
Organism Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OE131_RS27885 Protein ID WP_004213072.1
Coordinates 142625..143068 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OE131_RS27890 Protein ID WP_004213073.1
Coordinates 143065..143295 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE131_RS27850 (OE131_27850) 138036..138311 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
OE131_RS27855 (OE131_27855) 138374..138865 + 492 WP_011251327.1 DM13 domain-containing protein -
OE131_RS27860 (OE131_27860) 138914..139834 + 921 WP_004213934.1 DUF1471 domain-containing protein -
OE131_RS27865 (OE131_27865) 139925..140328 + 404 Protein_153 GAF domain-containing protein -
OE131_RS27870 (OE131_27870) 140846..141481 - 636 Protein_154 mucoid phenotype regulator RmpA2 -
OE131_RS27875 (OE131_27875) 141898..142202 + 305 Protein_155 transposase -
OE131_RS27880 (OE131_27880) 142225..142476 - 252 WP_186987481.1 hypothetical protein -
OE131_RS27885 (OE131_27885) 142625..143068 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OE131_RS27890 (OE131_27890) 143065..143295 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OE131_RS27895 (OE131_27895) 143903..145036 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
OE131_RS27900 (OE131_27900) 145052..145345 + 294 WP_004213076.1 hypothetical protein -
OE131_RS27905 (OE131_27905) 145335..145541 - 207 WP_004213077.1 hypothetical protein -
OE131_RS27910 (OE131_27910) 145893..146183 + 291 WP_004213078.1 hypothetical protein -
OE131_RS27915 (OE131_27915) 146173..147072 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..216672 216672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260027 WP_004213072.1 NZ_CP106913:c143068-142625 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260027 WP_004213073.1 NZ_CP106913:c143295-143065 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References