Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4201137..4201756 Replicon chromosome
Accession NZ_CP106912
Organism Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OE131_RS20990 Protein ID WP_002892050.1
Coordinates 4201538..4201756 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OE131_RS20985 Protein ID WP_002892066.1
Coordinates 4201137..4201511 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE131_RS20975 (OE131_20975) 4196289..4197482 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OE131_RS20980 (OE131_20980) 4197505..4200651 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OE131_RS20985 (OE131_20985) 4201137..4201511 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OE131_RS20990 (OE131_20990) 4201538..4201756 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OE131_RS20995 (OE131_20995) 4201915..4202481 + 567 WP_002892030.1 maltose O-acetyltransferase -
OE131_RS21000 (OE131_21000) 4202453..4202593 - 141 WP_004147370.1 hypothetical protein -
OE131_RS21005 (OE131_21005) 4202614..4203084 + 471 WP_002892026.1 YlaC family protein -
OE131_RS21010 (OE131_21010) 4203059..4204510 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OE131_RS21015 (OE131_21015) 4204611..4205309 + 699 WP_002892021.1 GNAT family protein -
OE131_RS21020 (OE131_21020) 4205306..4205446 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OE131_RS21025 (OE131_21025) 4205446..4205709 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260020 WP_002892050.1 NZ_CP106912:4201538-4201756 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260020 WP_002892066.1 NZ_CP106912:4201137-4201511 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References