Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 5581..6161 | Replicon | plasmid unnamed5 |
Accession | NZ_CP106911 | ||
Organism | Klebsiella pneumoniae strain BSIKPN-11 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OE130_RS30910 | Protein ID | WP_071177730.1 |
Coordinates | 5581..5895 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OE130_RS30915 | Protein ID | WP_000093040.1 |
Coordinates | 5883..6161 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OE130_RS30885 (OE130_30885) | 1525..3489 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
OE130_RS30890 (OE130_30890) | 3489..4220 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OE130_RS30895 (OE130_30895) | 4227..4757 | + | 531 | WP_071177729.1 | hypothetical protein | - |
OE130_RS30900 (OE130_30900) | 4784..4963 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OE130_RS30905 (OE130_30905) | 4989..5417 | - | 429 | WP_001140599.1 | hypothetical protein | - |
OE130_RS30910 (OE130_30910) | 5581..5895 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OE130_RS30915 (OE130_30915) | 5883..6161 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OE130_RS30920 (OE130_30920) | 6336..6701 | - | 366 | WP_072354022.1 | TonB family protein | - |
OE130_RS30925 (OE130_30925) | 6698..7069 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OE130_RS30930 (OE130_30930) | 7343..7588 | - | 246 | WP_032440458.1 | hypothetical protein | - |
OE130_RS30935 (OE130_30935) | 7915..9600 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
OE130_RS30940 (OE130_30940) | 9610..9867 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T260010 WP_071177730.1 NZ_CP106911:c5895-5581 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|