Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 58370..59280 Replicon plasmid unnamed2
Accession NZ_CP106908
Organism Klebsiella pneumoniae strain BSIKPN-11

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OE130_RS28760 Protein ID WP_004026354.1
Coordinates 58810..59280 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OE130_RS28755 Protein ID WP_004026357.1
Coordinates 58370..58813 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE130_RS28725 (OE130_28725) 53405..53806 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
OE130_RS28730 (OE130_28730) 53879..54781 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
OE130_RS28735 (OE130_28735) 54924..55145 - 222 WP_004213615.1 hypothetical protein -
OE130_RS28740 (OE130_28740) 55207..56514 - 1308 Protein_64 FepA family TonB-dependent siderophore receptor -
OE130_RS28745 (OE130_28745) 56580..57560 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OE130_RS28750 (OE130_28750) 57766..58269 + 504 Protein_66 DUF4113 domain-containing protein -
OE130_RS28755 (OE130_28755) 58370..58813 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OE130_RS28760 (OE130_28760) 58810..59280 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OE130_RS28765 (OE130_28765) 59429..60126 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OE130_RS28770 (OE130_28770) 61512..62162 - 651 WP_068893702.1 DUF1173 family protein -
OE130_RS28775 (OE130_28775) 62195..62461 - 267 WP_223175074.1 DUF1173 family protein -
OE130_RS28780 (OE130_28780) 62639..63133 + 495 WP_004212794.1 thermonuclease family protein -
OE130_RS28785 (OE130_28785) 63470..63868 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..216672 216672
- inside IScluster/Tn - - 56580..65319 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260007 WP_004026354.1 NZ_CP106908:58810-59280 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260007 WP_004026357.1 NZ_CP106908:58370-58813 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References