Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 19746..20416 Replicon plasmid unnamed2
Accession NZ_CP106908
Organism Klebsiella pneumoniae strain BSIKPN-11

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OE130_RS28520 Protein ID WP_004213072.1
Coordinates 19973..20416 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OE130_RS28515 Protein ID WP_004213073.1
Coordinates 19746..19976 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE130_RS28490 (OE130_28490) 15969..16868 - 900 WP_004225022.1 nucleotide-binding protein -
OE130_RS28495 (OE130_28495) 16858..17148 - 291 WP_004213078.1 hypothetical protein -
OE130_RS28500 (OE130_28500) 17500..17706 + 207 WP_004213077.1 hypothetical protein -
OE130_RS28505 (OE130_28505) 17696..17989 - 294 WP_004213076.1 hypothetical protein -
OE130_RS28510 (OE130_28510) 18005..19138 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
OE130_RS28515 (OE130_28515) 19746..19976 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OE130_RS28520 (OE130_28520) 19973..20416 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OE130_RS28525 (OE130_28525) 20565..20816 + 252 WP_186987481.1 hypothetical protein -
OE130_RS28530 (OE130_28530) 20839..21143 - 305 Protein_22 transposase -
OE130_RS28535 (OE130_28535) 21560..22195 + 636 Protein_23 mucoid phenotype regulator RmpA2 -
OE130_RS28540 (OE130_28540) 22713..23116 - 404 Protein_24 GAF domain-containing protein -
OE130_RS28545 (OE130_28545) 23207..24127 - 921 WP_004213934.1 DUF1471 domain-containing protein -
OE130_RS28550 (OE130_28550) 24176..24667 - 492 WP_011251327.1 DM13 domain-containing protein -
OE130_RS28555 (OE130_28555) 24730..25005 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..216672 216672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260006 WP_004213072.1 NZ_CP106908:19973-20416 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260006 WP_004213073.1 NZ_CP106908:19746-19976 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References