Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 124619..125262 Replicon plasmid unnamed1
Accession NZ_CP106907
Organism Klebsiella pneumoniae strain BSIKPN-11

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OE130_RS27965 Protein ID WP_001044770.1
Coordinates 124846..125262 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OE130_RS27960 Protein ID WP_001261282.1
Coordinates 124619..124849 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE130_RS27925 (119842) 119842..120621 - 780 WP_013214009.1 site-specific integrase -
OE130_RS27930 (120805) 120805..121809 - 1005 WP_011977814.1 hypothetical protein -
OE130_RS27935 (121839) 121839..122042 - 204 WP_235295287.1 hypothetical protein -
OE130_RS27940 (122088) 122088..122609 - 522 WP_013214008.1 hypothetical protein -
OE130_RS27945 (122667) 122667..123059 - 393 WP_011977811.1 hypothetical protein -
OE130_RS27950 (123096) 123096..124040 - 945 WP_011977810.1 hypothetical protein -
OE130_RS27955 (124201) 124201..124662 - 462 WP_014343465.1 hypothetical protein -
OE130_RS27960 (124619) 124619..124849 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OE130_RS27965 (124846) 124846..125262 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OE130_RS27970 (125336) 125336..126898 + 1563 WP_004206609.1 AAA family ATPase -
OE130_RS27975 (126883) 126883..127905 + 1023 WP_000361404.1 helicase UvrD -
OE130_RS27980 (128161) 128161..128858 + 698 WP_223174630.1 IS1 family transposase -
OE130_RS27985 (128887) 128887..129051 + 165 Protein_177 IS5/IS1182 family transposase -
OE130_RS27990 (129111) 129111..129815 + 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid rmtB / blaTEM-1B / fosA3 / blaKPC-2 - 1..216864 216864


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260005 WP_001044770.1 NZ_CP106907:124846-125262 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260005 WP_001261282.1 NZ_CP106907:124619-124849 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References