Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 69286..69929 Replicon plasmid unnamed2
Accession NZ_CP106896
Organism Enterobacter hormaechei strain EHX_PAT_001

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N6139_RS24580 Protein ID WP_001044770.1
Coordinates 69513..69929 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N6139_RS24575 Protein ID WP_001261282.1
Coordinates 69286..69516 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6139_RS24545 (N6139_24535) 64323..65123 - 801 WP_013263789.1 subclass B1 metallo-beta-lactamase VIM-1 -
N6139_RS24550 (N6139_24540) 65290..66303 + 1014 WP_000845039.1 class 1 integron integrase IntI1 -
N6139_RS24555 (N6139_24545) 66627..67331 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
N6139_RS24560 (N6139_24550) 67378..67515 - 138 WP_165592763.1 hypothetical protein -
N6139_RS24565 (N6139_24555) 68323..68775 + 453 WP_004201034.1 hypothetical protein -
N6139_RS24570 (N6139_24560) 69102..69329 - 228 Protein_71 hypothetical protein -
N6139_RS24575 (N6139_24565) 69286..69516 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N6139_RS24580 (N6139_24570) 69513..69929 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N6139_RS24585 (N6139_24575) 70003..70692 + 690 Protein_74 AAA family ATPase -
N6139_RS24590 (N6139_24580) 70747..71444 + 698 WP_223174630.1 IS1 family transposase -
N6139_RS24595 (N6139_24585) 71460..71570 + 111 Protein_76 mercuric transport protein periplasmic component -
N6139_RS24600 (N6139_24590) 71606..72028 + 423 WP_001340589.1 organomercurial transporter MerC -
N6139_RS24605 (N6139_24595) 72080..73774 + 1695 WP_000105636.1 mercury(II) reductase -
N6139_RS24610 (N6139_24600) 73792..74154 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
N6139_RS24615 (N6139_24605) 74151..74387 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aac(6')-Il / blaVIM-1 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib - 1..156088 156088
- inside IScluster/Tn mph(A) / sul1 / qacE / aac(6')-Il / blaVIM-1 - 53539..71444 17905


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T259983 WP_001044770.1 NZ_CP106896:69513-69929 [Enterobacter hormaechei]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT259983 WP_001261282.1 NZ_CP106896:69286-69516 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References