Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 51723..52366 Replicon plasmid unnamed2
Accession NZ_CP106896
Organism Enterobacter hormaechei strain EHX_PAT_001

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag N6139_RS24465 Protein ID WP_008322233.1
Coordinates 51723..52139 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag N6139_RS24470 Protein ID WP_001261276.1
Coordinates 52136..52366 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6139_RS24450 (N6139_24440) 47793..48812 + 1020 WP_004113181.1 ribose ABC transporter permease -
N6139_RS24455 (N6139_24445) 48890..50260 + 1371 WP_008322237.1 hypothetical protein -
N6139_RS24460 (N6139_24450) 50257..51177 + 921 WP_008322235.1 carbohydrate kinase -
N6139_RS24465 (N6139_24455) 51723..52139 - 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
N6139_RS24470 (N6139_24460) 52136..52366 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N6139_RS24475 (N6139_24465) 52619..53548 - 930 WP_058675113.1 hypothetical protein -
N6139_RS24480 (N6139_24470) 53539..54243 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
N6139_RS24485 (N6139_24475) 54365..55270 + 906 WP_000219391.1 Mph(A) family macrolide 2'-phosphotransferase -
N6139_RS24490 (N6139_24480) 55267..56505 + 1239 WP_000004159.1 macrolide resistance MFS transporter Mrx(A) -
N6139_RS24495 (N6139_24485) 56505..57089 + 585 WP_001137892.1 macrolide-binding transcriptional repressor MphR(A) -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aac(6')-Il / blaVIM-1 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib - 1..156088 156088
- inside IScluster/Tn mph(A) / sul1 / qacE / aac(6')-Il / blaVIM-1 - 53539..71444 17905


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T259982 WP_008322233.1 NZ_CP106896:c52139-51723 [Enterobacter hormaechei]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT259982 WP_001261276.1 NZ_CP106896:c52366-52136 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References