Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 32259..32998 | Replicon | plasmid unnamed2 |
Accession | NZ_CP106896 | ||
Organism | Enterobacter hormaechei strain EHX_PAT_001 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | N6139_RS24370 | Protein ID | WP_058675171.1 |
Coordinates | 32513..32998 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A085GLQ4 |
Locus tag | N6139_RS24365 | Protein ID | WP_032611697.1 |
Coordinates | 32259..32525 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6139_RS24355 (N6139_24345) | 27551..30517 | + | 2967 | WP_001138064.1 | Tn3-like element TnAs3 family transposase | - |
N6139_RS24360 (N6139_24350) | 30668..31906 | - | 1239 | WP_058675170.1 | IS110 family transposase | - |
N6139_RS24365 (N6139_24355) | 32259..32525 | + | 267 | WP_032611697.1 | DUF1778 domain-containing protein | Antitoxin |
N6139_RS24370 (N6139_24360) | 32513..32998 | + | 486 | WP_058675171.1 | GNAT family N-acetyltransferase | Toxin |
N6139_RS24375 (N6139_24365) | 33417..34106 | + | 690 | Protein_32 | ISNCY family transposase | - |
N6139_RS24380 (N6139_24370) | 34170..35317 | + | 1148 | Protein_33 | IS3 family transposase | - |
N6139_RS24385 (N6139_24375) | 35336..35944 | - | 609 | Protein_34 | DNA (cytosine-5-)-methyltransferase | - |
N6139_RS24390 (N6139_24380) | 36350..37339 | - | 990 | WP_058675112.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aac(6')-Il / blaVIM-1 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib | - | 1..156088 | 156088 | |
- | inside | IScluster/Tn | - | - | 10037..42325 | 32288 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17692.47 Da Isoelectric Point: 9.8719
>T259981 WP_058675171.1 NZ_CP106896:32513-32998 [Enterobacter hormaechei]
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|