Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3823051..3823708 | Replicon | chromosome |
| Accession | NZ_CP106894 | ||
| Organism | Enterobacter hormaechei strain EHX_PAT_001 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A837FG63 |
| Locus tag | N6139_RS18530 | Protein ID | WP_003863439.1 |
| Coordinates | 3823051..3823461 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | N6139_RS18535 | Protein ID | WP_003863437.1 |
| Coordinates | 3823442..3823708 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6139_RS18510 (N6139_18500) | 3819049..3820782 | - | 1734 | WP_022651808.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N6139_RS18515 (N6139_18505) | 3820788..3821501 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N6139_RS18520 (N6139_18510) | 3821530..3822426 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| N6139_RS18525 (N6139_18515) | 3822528..3823049 | + | 522 | WP_003863440.1 | flavodoxin FldB | - |
| N6139_RS18530 (N6139_18520) | 3823051..3823461 | - | 411 | WP_003863439.1 | protein YgfX | Toxin |
| N6139_RS18535 (N6139_18525) | 3823442..3823708 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| N6139_RS18540 (N6139_18530) | 3824003..3824983 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| N6139_RS18545 (N6139_18535) | 3825069..3825728 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N6139_RS18550 (N6139_18540) | 3825995..3826726 | + | 732 | WP_023314798.1 | MurR/RpiR family transcriptional regulator | - |
| N6139_RS18555 (N6139_18545) | 3826843..3828276 | + | 1434 | WP_003863430.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16339.24 Da Isoelectric Point: 11.4775
>T259978 WP_003863439.1 NZ_CP106894:c3823461-3823051 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FG63 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |