Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2294582..2295321 | Replicon | chromosome |
Accession | NZ_CP106894 | ||
Organism | Enterobacter hormaechei strain EHX_PAT_001 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A837FFP9 |
Locus tag | N6139_RS10965 | Protein ID | WP_032609220.1 |
Coordinates | 2294582..2295067 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | N6139_RS10970 | Protein ID | WP_003857131.1 |
Coordinates | 2295055..2295321 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6139_RS10935 (N6139_10930) | 2290073..2290645 | + | 573 | WP_045346197.1 | NAD(P)H-dependent oxidoreductase | - |
N6139_RS10940 (N6139_10935) | 2290648..2291667 | + | 1020 | WP_045346198.1 | aldo/keto reductase | - |
N6139_RS10945 (N6139_10940) | 2291706..2292083 | + | 378 | WP_023292403.1 | DUF1330 domain-containing protein | - |
N6139_RS10950 (N6139_10945) | 2292177..2292725 | + | 549 | WP_058674708.1 | NAD(P)H-dependent oxidoreductase | - |
N6139_RS10955 (N6139_10950) | 2292766..2293461 | + | 696 | WP_058674671.1 | antibiotic biosynthesis monooxygenase | - |
N6139_RS10960 (N6139_10955) | 2293477..2294280 | + | 804 | WP_045346200.1 | carboxymuconolactone decarboxylase family protein | - |
N6139_RS10965 (N6139_10960) | 2294582..2295067 | - | 486 | WP_032609220.1 | GNAT family N-acetyltransferase | Toxin |
N6139_RS10970 (N6139_10965) | 2295055..2295321 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
N6139_RS10975 (N6139_10970) | 2295385..2296314 | - | 930 | WP_045346202.1 | LysR family transcriptional regulator | - |
N6139_RS10980 (N6139_10975) | 2296444..2297832 | + | 1389 | WP_058674672.1 | MFS transporter | - |
N6139_RS10985 (N6139_10980) | 2297854..2298849 | - | 996 | WP_048240773.1 | DUF2891 domain-containing protein | - |
N6139_RS10990 (N6139_10985) | 2298859..2299845 | - | 987 | WP_022651202.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17554.26 Da Isoelectric Point: 9.9658
>T259972 WP_032609220.1 NZ_CP106894:c2295067-2294582 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVICKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVICKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |