Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4180318..4180937 Replicon chromosome
Accession NZ_CP106890
Organism Klebsiella pneumoniae strain KPN_SINK_001

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N6138_RS20820 Protein ID WP_002892050.1
Coordinates 4180719..4180937 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N6138_RS20815 Protein ID WP_002892066.1
Coordinates 4180318..4180692 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6138_RS20805 (N6138_20800) 4175470..4176663 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N6138_RS20810 (N6138_20805) 4176686..4179832 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N6138_RS20815 (N6138_20810) 4180318..4180692 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N6138_RS20820 (N6138_20815) 4180719..4180937 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N6138_RS20825 (N6138_20820) 4181096..4181662 + 567 WP_002892030.1 maltose O-acetyltransferase -
N6138_RS20830 (N6138_20825) 4181634..4181774 - 141 WP_004147370.1 hypothetical protein -
N6138_RS20835 (N6138_20830) 4181795..4182265 + 471 WP_002892026.1 YlaC family protein -
N6138_RS20840 (N6138_20835) 4182240..4183691 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N6138_RS20845 (N6138_20840) 4183792..4184490 + 699 WP_002892021.1 GNAT family protein -
N6138_RS20850 (N6138_20845) 4184487..4184627 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N6138_RS20855 (N6138_20850) 4184627..4184890 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259961 WP_002892050.1 NZ_CP106890:4180719-4180937 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259961 WP_002892066.1 NZ_CP106890:4180318-4180692 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References