Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 907440..908097 | Replicon | chromosome |
Accession | NZ_CP106890 | ||
Organism | Klebsiella pneumoniae strain KPN_SINK_001 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | N6138_RS04630 | Protein ID | WP_002916310.1 |
Coordinates | 907687..908097 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | N6138_RS04625 | Protein ID | WP_002916312.1 |
Coordinates | 907440..907706 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6138_RS04600 (N6138_04600) | 902596..904029 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
N6138_RS04605 (N6138_04605) | 904148..904876 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
N6138_RS04610 (N6138_04610) | 904926..905237 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
N6138_RS04615 (N6138_04615) | 905401..906060 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
N6138_RS04620 (N6138_04620) | 906211..907194 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
N6138_RS04625 (N6138_04625) | 907440..907706 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
N6138_RS04630 (N6138_04630) | 907687..908097 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
N6138_RS04635 (N6138_04635) | 908104..908625 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
N6138_RS04640 (N6138_04640) | 908726..909622 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
N6138_RS04645 (N6138_04645) | 909645..910358 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N6138_RS04650 (N6138_04650) | 910364..912097 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T259955 WP_002916310.1 NZ_CP106890:907687-908097 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |