Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 84880..85403 Replicon plasmid unnamed2
Accession NZ_CP106888
Organism Klebsiella pneumoniae strain KPN_PAT_001

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag N6137_RS28535 Protein ID WP_015632464.1
Coordinates 84880..85185 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag N6137_RS28540 Protein ID WP_015632465.1
Coordinates 85185..85403 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6137_RS28495 (N6137_28490) 80451..81311 - 861 WP_286453394.1 plasmid segregation protein ParM -
N6137_RS28500 (N6137_28495) 81672..81854 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
N6137_RS28505 (N6137_28500) 81880..82323 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
N6137_RS28510 (N6137_28505) 82529..82651 - 123 Protein_91 transcriptional regulator -
N6137_RS28515 (N6137_28510) 82665..82892 - 228 WP_016162072.1 hypothetical protein -
N6137_RS28520 (N6137_28515) 83124..83579 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
N6137_RS28525 (N6137_28520) 83831..83926 - 96 Protein_94 IS1 family transposase -
N6137_RS28530 (N6137_28525) 84391..84768 - 378 WP_016162069.1 hypothetical protein -
N6137_RS28535 (N6137_28530) 84880..85185 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
N6137_RS28540 (N6137_28535) 85185..85403 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N6137_RS28545 (N6137_28540) 85589..86614 + 1026 WP_015632466.1 IS110 family transposase -
N6137_RS28550 (N6137_28545) 86909..87394 + 486 Protein_99 IS5 family transposase -
N6137_RS28555 (N6137_28550) 87558..87989 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
N6137_RS28560 (N6137_28555) 87989..89260 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaNDM-1 / dfrA14 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..89653 89653
- flank IS/Tn - - 85589..86614 1025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T259951 WP_015632464.1 NZ_CP106888:c85185-84880 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT259951 WP_015632465.1 NZ_CP106888:c85403-85185 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References