Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6190..6833 Replicon plasmid unnamed2
Accession NZ_CP106888
Organism Klebsiella pneumoniae strain KPN_PAT_001

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N6137_RS28105 Protein ID WP_001044770.1
Coordinates 6417..6833 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N6137_RS28100 Protein ID WP_001261282.1
Coordinates 6190..6420 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6137_RS28060 (N6137_28055) 1535..2161 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
N6137_RS28065 (N6137_28060) 2158..2460 + 303 WP_004197636.1 hypothetical protein -
N6137_RS28070 (N6137_28065) 2892..3686 - 795 WP_015632375.1 site-specific integrase -
N6137_RS28075 (N6137_28070) 3679..3840 - 162 WP_032495756.1 hypothetical protein -
N6137_RS28080 (N6137_28075) 3884..4888 - 1005 WP_016162067.1 hypothetical protein -
N6137_RS28085 (N6137_28080) 4953..5264 - 312 WP_024191724.1 hypothetical protein -
N6137_RS28090 (N6137_28085) 5313..5627 - 315 WP_015632378.1 hypothetical protein -
N6137_RS28095 (N6137_28090) 5772..6233 - 462 WP_165763053.1 hypothetical protein -
N6137_RS28100 (N6137_28095) 6190..6420 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N6137_RS28105 (N6137_28100) 6417..6833 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N6137_RS28110 (N6137_28105) 6907..7596 + 690 Protein_11 AAA family ATPase -
N6137_RS28115 (N6137_28110) 7651..8348 + 698 WP_223174630.1 IS1 family transposase -
N6137_RS28120 (N6137_28115) 8365..8556 - 192 Protein_13 nucleotidyltransferase domain-containing protein -
N6137_RS28125 (N6137_28120) 8626..9180 - 555 WP_071846332.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
N6137_RS28130 (N6137_28125) 9414..9971 - 558 WP_001217881.1 recombinase family protein -
N6137_RS28135 (N6137_28130) 10135..10353 + 219 WP_001143771.1 DUF4158 domain-containing protein -
N6137_RS28140 (N6137_28135) 10535..11797 + 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaNDM-1 / dfrA14 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..89653 89653


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T259950 WP_001044770.1 NZ_CP106888:6417-6833 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT259950 WP_001261282.1 NZ_CP106888:6190-6420 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References