Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 6190..6833 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP106888 | ||
| Organism | Klebsiella pneumoniae strain KPN_PAT_001 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | N6137_RS28105 | Protein ID | WP_001044770.1 |
| Coordinates | 6417..6833 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | N6137_RS28100 | Protein ID | WP_001261282.1 |
| Coordinates | 6190..6420 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6137_RS28060 (N6137_28055) | 1535..2161 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
| N6137_RS28065 (N6137_28060) | 2158..2460 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| N6137_RS28070 (N6137_28065) | 2892..3686 | - | 795 | WP_015632375.1 | site-specific integrase | - |
| N6137_RS28075 (N6137_28070) | 3679..3840 | - | 162 | WP_032495756.1 | hypothetical protein | - |
| N6137_RS28080 (N6137_28075) | 3884..4888 | - | 1005 | WP_016162067.1 | hypothetical protein | - |
| N6137_RS28085 (N6137_28080) | 4953..5264 | - | 312 | WP_024191724.1 | hypothetical protein | - |
| N6137_RS28090 (N6137_28085) | 5313..5627 | - | 315 | WP_015632378.1 | hypothetical protein | - |
| N6137_RS28095 (N6137_28090) | 5772..6233 | - | 462 | WP_165763053.1 | hypothetical protein | - |
| N6137_RS28100 (N6137_28095) | 6190..6420 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N6137_RS28105 (N6137_28100) | 6417..6833 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N6137_RS28110 (N6137_28105) | 6907..7596 | + | 690 | Protein_11 | AAA family ATPase | - |
| N6137_RS28115 (N6137_28110) | 7651..8348 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| N6137_RS28120 (N6137_28115) | 8365..8556 | - | 192 | Protein_13 | nucleotidyltransferase domain-containing protein | - |
| N6137_RS28125 (N6137_28120) | 8626..9180 | - | 555 | WP_071846332.1 | AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase | - |
| N6137_RS28130 (N6137_28125) | 9414..9971 | - | 558 | WP_001217881.1 | recombinase family protein | - |
| N6137_RS28135 (N6137_28130) | 10135..10353 | + | 219 | WP_001143771.1 | DUF4158 domain-containing protein | - |
| N6137_RS28140 (N6137_28135) | 10535..11797 | + | 1263 | WP_000608644.1 | IS1380-like element ISEcp1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaNDM-1 / dfrA14 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..89653 | 89653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T259950 WP_001044770.1 NZ_CP106888:6417-6833 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |