Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5378156..5378781 | Replicon | chromosome |
Accession | NZ_CP106886 | ||
Organism | Klebsiella pneumoniae strain KPN_PAT_001 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | N6137_RS26575 | Protein ID | WP_002882817.1 |
Coordinates | 5378156..5378539 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | N6137_RS26580 | Protein ID | WP_004150355.1 |
Coordinates | 5378539..5378781 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6137_RS26560 (N6137_26555) | 5375522..5376424 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
N6137_RS26565 (N6137_26560) | 5376421..5377056 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N6137_RS26570 (N6137_26565) | 5377053..5377982 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N6137_RS26575 (N6137_26570) | 5378156..5378539 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N6137_RS26580 (N6137_26575) | 5378539..5378781 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
N6137_RS26585 (N6137_26580) | 5378986..5379903 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
N6137_RS26590 (N6137_26585) | 5379917..5380858 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N6137_RS26595 (N6137_26590) | 5380903..5381340 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N6137_RS26600 (N6137_26595) | 5381337..5382197 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
N6137_RS26605 (N6137_26600) | 5382191..5382790 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T259948 WP_002882817.1 NZ_CP106886:c5378539-5378156 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |