Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4180133..4180752 | Replicon | chromosome |
Accession | NZ_CP106886 | ||
Organism | Klebsiella pneumoniae strain KPN_PAT_001 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | N6137_RS20825 | Protein ID | WP_002892050.1 |
Coordinates | 4180534..4180752 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | N6137_RS20820 | Protein ID | WP_002892066.1 |
Coordinates | 4180133..4180507 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6137_RS20810 (N6137_20805) | 4175285..4176478 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N6137_RS20815 (N6137_20810) | 4176501..4179647 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N6137_RS20820 (N6137_20815) | 4180133..4180507 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
N6137_RS20825 (N6137_20820) | 4180534..4180752 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
N6137_RS20830 (N6137_20825) | 4180911..4181477 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
N6137_RS20835 (N6137_20830) | 4181449..4181589 | - | 141 | WP_004147370.1 | hypothetical protein | - |
N6137_RS20840 (N6137_20835) | 4181610..4182080 | + | 471 | WP_002892026.1 | YlaC family protein | - |
N6137_RS20845 (N6137_20840) | 4182055..4183506 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
N6137_RS20850 (N6137_20845) | 4183607..4184305 | + | 699 | WP_002892021.1 | GNAT family protein | - |
N6137_RS20855 (N6137_20850) | 4184302..4184442 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
N6137_RS20860 (N6137_20855) | 4184442..4184705 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T259944 WP_002892050.1 NZ_CP106886:4180534-4180752 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT259944 WP_002892066.1 NZ_CP106886:4180133-4180507 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |