Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5900038..5900662 | Replicon | chromosome |
Accession | NZ_CP106885 | ||
Organism | Achromobacter spanius strain LIG3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N8Z00_RS26520 | Protein ID | WP_268079350.1 |
Coordinates | 5900038..5900220 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N8Z00_RS26525 | Protein ID | WP_268079351.1 |
Coordinates | 5900270..5900662 (+) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8Z00_RS26490 (N8Z00_26490) | 5895850..5896719 | - | 870 | WP_268079346.1 | alpha/beta hydrolase | - |
N8Z00_RS26495 (N8Z00_26495) | 5896970..5897887 | - | 918 | WP_268079347.1 | DUF808 domain-containing protein | - |
N8Z00_RS26500 (N8Z00_26500) | 5898080..5898337 | - | 258 | WP_259251979.1 | hypothetical protein | - |
N8Z00_RS26505 (N8Z00_26505) | 5898406..5898609 | - | 204 | WP_050448526.1 | cold-shock protein | - |
N8Z00_RS26510 (N8Z00_26510) | 5899072..5899509 | + | 438 | WP_268079348.1 | hypothetical protein | - |
N8Z00_RS26515 (N8Z00_26515) | 5899528..5899869 | - | 342 | WP_268079349.1 | hypothetical protein | - |
N8Z00_RS26520 (N8Z00_26520) | 5900038..5900220 | + | 183 | WP_268079350.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N8Z00_RS26525 (N8Z00_26525) | 5900270..5900662 | + | 393 | WP_268079351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N8Z00_RS26530 (N8Z00_26530) | 5900703..5901443 | - | 741 | WP_268079352.1 | SDR family oxidoreductase | - |
N8Z00_RS26535 (N8Z00_26535) | 5901481..5902818 | - | 1338 | WP_268082501.1 | CitMHS family transporter | - |
N8Z00_RS26540 (N8Z00_26540) | 5903011..5903715 | + | 705 | WP_268079353.1 | response regulator transcription factor | - |
N8Z00_RS26545 (N8Z00_26545) | 5903719..5905173 | + | 1455 | WP_268079354.1 | sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6765.99 Da Isoelectric Point: 12.1585
>T259934 WP_268079350.1 NZ_CP106885:5900038-5900220 [Achromobacter spanius]
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13915.77 Da Isoelectric Point: 4.2687
>AT259934 WP_268079351.1 NZ_CP106885:5900270-5900662 [Achromobacter spanius]
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|